PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000132623
Common NameNAC17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 336aa    MW: 37565.2 Da    PI: 8.6553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000132623genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.81.5e-51141391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Ptdeel+v+yL++kv+g +++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ +gyWkatg+dk +++ +
  MDP0000132623  14 LPPGFRFYPTDEELLVQYLCRKVAGYQFNL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGTGYWKATGTDKVITT-E 107
                    79****************************.89***************7777799*************************************99.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g++vg+kk Lvfy g+apkg kt+W+mheyrl
  MDP0000132623 108 GKKVGIKKALVFYVGKAPKGIKTNWIMHEYRL 139
                    99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-6610162IPR003441NAC domain
PROSITE profilePS5100559.81914162IPR003441NAC domain
PfamPF023651.7E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGYQ FNLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GTGYWKATGT DKVITTEGKK VGIKKALVFY  120
VGKAPKGIKT NWIMHEYRLI EPSRKNGSSK LDEWVLCRIY KKSTSSAAAA AAQKSVTSVS  180
GKEHSNGSSS PCSSQLDDGL EWLPDIDDRF FTLPRINSLK TLQQQDSKLN FQNTGSGNFD  240
WASLAGLNSA AELGLNNQTQ QGQGQVNLNY NDNDMFVPSI PSLCHVESRP ERVGKTAEEE  300
VQSGLRTQRV DNSGFIQQNS QNFCNPVRPG GFGLWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-11011664169NAC domain-containing protein 19
4dul_A1e-11011664169NAC domain-containing protein 19
1ut7_B1e-11011664169NO APICAL MERISTEM PROTEIN
1ut7_A1e-11011664169NO APICAL MERISTEM PROTEIN
1ut4_B1e-11011664169NO APICAL MERISTEM PROTEIN
1ut4_A1e-11011664169NO APICAL MERISTEM PROTEIN
3swp_D1e-11011667172NAC domain-containing protein 19
3swp_C1e-11011667172NAC domain-containing protein 19
3swp_B1e-11011667172NAC domain-containing protein 19
3swp_A1e-11011667172NAC domain-containing protein 19
3swm_D1e-11011667172NAC domain-containing protein 19
3swm_C1e-11011667172NAC domain-containing protein 19
3swm_B1e-11011667172NAC domain-containing protein 19
3swm_A1e-11011667172NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.79160.0fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981300.0KF198130.1 Malus hupehensis NAC domain protein (NAC168) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378492.10.0PREDICTED: NAC domain-containing protein 72
RefseqXP_009378493.10.0PREDICTED: NAC domain-containing protein 72
SwissprotQ93VY31e-126NAC72_ARATH; NAC domain-containing protein 72
TrEMBLD9ZJ940.0D9ZJ94_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s12400.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-120NAC family protein